If you have been reading about LC-MS/MS and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-02-27. Numbers and descriptions here follow the published literature rather than marketing material.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved for human therapeutic use | No marketing authorization identified in major jurisdictions. |
| Anti-doping class | PPARδ agonist; hormone and metabolic modulators | Listed on the WADA Prohibited List. |
| Common test matrix | Urine | Also blood and tissue in research settings. |
| Typical analytical method | LC-MS/MS | Targets parent compound and metabolites. |
| Major safety signal | Tumor findings in rodents | Human relevance not established; limited human data. |
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Laboratory studies indicate that GW501516 activates PPARδ, a nuclear receptor involved in fatty acid oxidation and energy metabolism. In rodent experiments, treated animals often showed increased endurance and reduced fat mass. These effects were observed under controlled conditions and do not establish safe or effective use in humans. The exact dose-response relationship in humans remains poorly characterized. Species differences in metabolism can affect how results translate across animals and people.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
When taken in normal therapeutic doses, paracetamol has been shown to be safe. Following a therapeutic dose, it is mostly converted to nontoxic metabolites via Phase II metabolism by conjugation with sulfate and glucuronide, with a small portion being oxidized via the cytochrome P450 enzyme system. Cytochromes P450 2E1 and 3A4 convert approximately 5% of paracetamol to a highly reactive intermediary metabolite, N-acetyl-p-benzoquinone imine (NAPQI). Under normal conditions, NAPQI is detoxified by conjugation with glutathione to form cysteine and mercapturic acid conjugates. In cases of paracetamol overdose, the sulfate and glucuronide pathways become saturated, and more paracetamol is shunted to the cytochrome P450 system to produce NAPQI. As a result, hepatocellular supplies of glutathione become depleted, as the demand for glutathione is higher than its regeneration. NAPQI therefore remains in its toxic form in the liver and reacts with cellular membrane molecules, resulting in widespread hepatocyte damage and death, leading to acute liver necrosis. In animal studies, the liver's stores of glutathione must be depleted to less than 70% of normal levels before liver toxicity occurs.
== Further reading == Foreman, John C.; Johansen, Torben; Gibb, Alasdair J., eds. (2010). Textbook of Receptor Pharmacology. doi:10.1201/9781420052558. ISBN 978-0-429-14730-2. Brunton L (2011). Brunton LL, Chabner B, Knollmann BC (eds.). Goodman and Gilman's The Pharmacological Basis of Therapeutics (12 ed.). New York: McGraw-Hill. ISBN 978-0-07-162442-8. Whalen K (2014). Lippincott Illustrated Reviews: Pharmacology.
== Relevance to immunology == Because fMet is present in proteins made by bacteria but not in those made by eukaryotes (other than in bacterially derived organelles), the immune system might use it to help distinguish self from non-self. Polymorphonuclear cells can bind proteins starting with fMet, and use them to initiate the attraction of circulating blood leukocytes and then stimulate microbicidal activities such as phagocytosis. Since fMet is present in proteins made by mitochondria and chloroplasts, more recent theories do not see it as a molecule that the immune system can use to distinguish self from non-self. Instead, fMet-containing oligopeptides and proteins appear to be released by the mitochondria of damaged tissues as well as by damaged bacteria, and can thus qualify as an "alarm" signal, as discussed in the Danger model of immunity. The prototypical fMet-containing oligopeptide is N-formylmethionine-leucyl-phenylalanine (FMLP) which activates leukocytes and other cell types by binding with these cells' formyl peptide receptor 1 (FPR1) and formyl peptide receptor 2 (FPR2) G protein coupled receptors (see also formyl peptide receptor 3). Acting through these receptors, the fMet-containing oligopeptides and proteins are part of the innate immune system; they function to initiate acute inflammation responses but under other conditions function to inhibit and resolve these responses. fMet-containing oligopeptides and proteins also function in other physiological and pathological responses.
A monopeptide has one amino acid (not alone but combined with (an)other type(s) of molecule(s)). A dipeptide has two amino acids. A tripeptide has three amino acids. A tetrapeptide has four amino acids. A pentapeptide has five amino acids. (e.g., enkephalin). A hexapeptide has six amino acids. (e.g., angiotensin IV). A heptapeptide has seven amino acids. (e.g., spinorphin). An octapeptide has eight amino acids (e.g., angiotensin II). A nonapeptide has nine amino acids (e.g., oxytocin). A decapeptide has ten amino acids (e.g., gonadotropin-releasing hormone and angiotensin I). A undecapeptide has eleven amino acids (e.g., substance P). The same words are also used to describe a group of residues in a larger polypeptide (e.g., RGD motif).
A small "pill" of opium about the size of a pea would be placed on the pipe-bowl, which was then heated by holding it over an opium lamp, a special oil lamp with a distinct funnel-like chimney to channel heat into a small area. The smoker would lie on their side in order to guide the pipe-bowl and the tiny pill of opium over the stream of heat rising from the chimney of the oil lamp and inhale the vaporized opium fumes as needed. Several pills of opium were smoked at a single session depending on the smoker's tolerance to the drug. The effects could last up to twelve hours. In Eastern culture, opium is more commonly used in the form of paregoric to treat diarrhea. This is a weaker solution than laudanum, an alcoholic tincture which was prevalently used as a pain medication and sleeping aid. Tincture of opium has been prescribed for, among other things, severe diarrhea. Taken thirty minutes prior to meals, it significantly slows intestinal motility, giving the intestines greater time to absorb fluid in the stool. Despite the historically negative view of opium as a cause of addiction, the use of morphine and other derivatives isolated from opium in the treatment of chronic pain has been reestablished. If given in controlled doses, modern opiates can be an effective treatment for neuropathic pain and other forms of chronic pain.
Sources: en.wikipedia.org
Methylnaltrexone bromide, naloxegol, and naldemedine all have similar structures, which is not far away from the chemical structure of morphine and other MOR-agonists. All contain a rigid pentacyclic structure that involves benzene ring (A), tetrahydrofuran ring (B), two cyclohexane rings (C and D) and a piperidine ring (E). The most important functional groups for the biological action of opioids are the hydroxyl group on the phenol, N-methyl group, ether bridge between C4 and C5, the double bond between carbon number C7 and C8 and the hydroxyl groups at C3 and C6. The phenolic ring and its 3-hydroxyl group is vital for the analgesic effects as the removal of the OH group decrease the analgesic activity 10-fold. There is another principle for the hydroxyl group on C6 as the removal enhances its activity. The increased activity is mainly because of the increased lipophilicity and the increased ability to cross the blood–brain barrier. Naldemedine has the hydroxyl group while methylnaltrexone bromide has a ketone group and naloxegol has an ester. The double bond between C7 and C8 is not required for the analgesic effect and reduction of the double bond will increase the activity. None of the antagonists has a double bond in their structure. The N-substituent on the skeleton is thought to determine the pharmacological behavior and its interaction with MOR. It is also thought to play a key role in distinguishing antagonists from agonists. Allyl group, a methylcyclopropyl group or a methylcyclobutyl as N-substituent groups are thought to lead antagonist activity.
being positive) when fully (or highly) ionized. Theoretically, this happens for the following 12 nuclides: 148Eu, 163Dy, 193Ir, 194Au, 202Tl, 205Tl, 213Po, 215At, 222Rn, 244Pu, 243Am, and 246Bk. The following table lists theoretically-possible bound-state β− transitions that are impossible for neutral atoms. The
=== Signaling pathways for mast cell activation === Specific signaling pathways of mast cells in different tissues provide mechanisms by which the immune system detects and is organized to deal with potential threats. Mast cells can be stimulated to degranulate by allergens through cross-linking with immunoglobulin E receptors (e.g., FcεRI), physical injury through pattern recognition receptors for damage-associated molecular patterns (DAMPs), microbial pathogens through pattern recognition receptors for pathogen-associated molecular patterns (PAMPs), and various compounds through their associated G-protein coupled receptors (e.g., morphine through opioid receptors) or ligand-gated ion channels. Complement proteins can activate membrane receptors on mast cells to exert various functions as well.
Historians Robert Friedel and Paul Israel list inventors of incandescent lamps prior to Joseph Swan and Thomas Edison of General Electric. They conclude that Edison's version was the first practical implementation, able to outstrip the others because of a combination of four factors: an effective incandescent material; a vacuum higher than other implementations; a high resistance that made power distribution from a centralized source economically viable, and the development of the associated components required for a large-scale lighting system. However, Joseph Swan's incandescent light bulb pre-dated Edison's and was sufficiently practical that it was actually installed and in daily use in London in 1881. Historian Thomas Hughes has attributed Edison's business success to his development of an entire, integrated system of electric lighting.
==== Supreme Court of Masonic Justice expels members ==== In June 2026, the Supreme Court of Masonic Justice permanently expelled eight members from the Grand Lodge and Supreme Council of Cuba, stripping them of their Masonic rights and privileges. Among those members expelled were;
Sources: en.wikipedia.org
Abiotic factors that can damage plants include heat, freezing, flooding, lightning strikes, ozone gas, and pollutant chemicals. Heat can kill any plant, given a sufficient temperature. Alpine plants tend to die at around 47 Celsius; temperate plants at around 51 Celsius; and tropical plants at nearly 58 Celsius: but there is some overlap depending on species. Similarly among cereal crops, temperate barley and oat die at around 49 Celsius, but tropical maize at 55 Celsius. Freezing affects plants variously, according to each species' ability to resist frost damage. Many forbs, including many garden flowers, are tender with little tolerance to frost, and die or are seriously damaged when frozen. Many woody plants are able to supercool, with tough buds and stems containing molecules that lower the freezing point or help to prevent the nucleation of ice crystals, and cell walls that mechanically protect cells against freezing. Flooding of soil quickly kills or injures many plants. The leaves become yellow (chlorosis) and die, progressively up the stem, within about five days after the roots are flooded. The roots lose the ability to absorb water and nutrients. Lightning strikes kill or injure plants, from root crops like beet and potato, which are instantly cooked in the ground, to trees such as coconut, through effects such as sudden heat and pressure shock waves created when water inside the plant flashes to steam. This can rupture stems and scorch any plant parts.
== External links == visfatin,+human at the U.S. National Library of Medicine Medical Subject Headings (MeSH) NAMPT human gene location in the UCSC Genome Browser. NAMPT human gene details in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: P43490 (Human Nicotinamide phosphoribosyltransferase) at the PDBe-KB. Overview of all the structural information available in the PDB for UniProt: Q99KQ4 (Mouse Nicotinamide phosphoribosyltransferase) at the PDBe-KB.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
=== Autonomic neuropathy === During hypoglycemia, the body normally releases epinephrine (more commonly known as adrenaline) and related substances. This serves two purposes: The β-effect of epinephrine is responsible for the palpitations and tremors, giving the patient warning that hypoglycemia is present. The β-effect of epinephrine also stimulates the liver to release glucose (gluconeogenesis and glycogenolysis). In other words, the epinephrine warns the patient that hypoglycemia is present and signals the liver to release glucose to reverse it. In the absence of epinephrine release, or when it is attenuated (reduced) during hypoglycemia, the patient may not be aware that his/her glucose level is low. This is termed 'hypoglycemic unawareness'. The problem is compounded since, in the absence of an appropriate epinephrine response, the usual responses of glycogenolysis and gluconeogenesis may also be lost or blunted. Since epinephrine release is a function of the autonomic nervous system, the presence of autonomic neuropathy (i.e., a damaged autonomic nervous system) will cause the epinephrine release in response to hypoglycemia to be lost or blunted. Unfortunately, damage to the autonomic nervous system in the form of autonomic neuropathy is a common complication of long-standing diabetes (especially type 1 diabetes), so the presence of hypoglycemic unawareness may be a sign of autonomic neuropathy, although the autonomic response to hypoglycemia is already impaired in patients with type 1 diabetes mellitus even in the absence of autonomic neuropathy.
There is a belief in the Western military doctrines that the PLA have already begun engaging countries using cyber-warfare. There has been a significant increase in the number of presumed Chinese military initiated cyber events from 1999 to the present day. Cyberwarfare has gained recognition as a valuable technique because it is an asymmetric technique that is a part of information operations and information warfare. As is written by two PLAGF Colonels, Qiao Liang and Wang Xiangsui in the book Unrestricted Warfare, "Methods that are not characterized by the use of the force of arms, nor by the use of military power, nor even by the presence of casualties and bloodshed, are just as likely to facilitate the successful realization of the war's goals, if not more so. While China has long been suspected of cyber spying, on 24 May 2011 the PLA announced the existence of having 'cyber capabilities'. In February 2013, the media named "Comment Crew" as a hacker military faction for China's People's Liberation Army. In May 2014, a Federal Grand Jury in the United States indicted five Unit 61398 officers on criminal charges related to cyber attacks on private companies based in the United States after alleged investigations by the Federal Bureau of Investigation who exposed their identities in collaboration with US intelligence agencies such as the CIA.
Sources: en.wikipedia.org
No. Cardarine has not received approval for human therapeutic use in major jurisdictions. It remains an investigational compound.
It is classified as a PPARδ agonist on the WADA Prohibited List. Anti-doping laboratories can detect it and its metabolites in urine. Its use is banned in competition and usually out of competition.
Rodent studies reported increased tumor incidence at multiple sites. The human relevance remains uncertain, but the findings contributed to discontinuation of development. No long-term human cancer data are available.
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.