If you have been reading about clinical development and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-04-13. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
Stability of GW501516 depends on form, temperature, light exposure, and moisture. Solid reference material is typically stored frozen or refrigerated in a desiccator and protected from light. Solutions in organic solvents such as dimethyl sulfoxide are often kept frozen in aliquots to reduce freeze-thaw cycling. Aqueous solubility is low, so aqueous stock solutions can be difficult to prepare without cosolvents. Degradation may appear as changes in chromatographic purity or mass spectral signal. Stability studies are needed to establish shelf life for any specific preparation.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | GW501516; GW-1516; endurobol | GW501516 is the research code |
| Drug class | PPARδ agonist | Not a selective androgen receptor modulator |
| Molecular formula | C21H18F3NO3S2 | Established chemical formula |
| Molar mass | 453.5 g/mol | Calculated from the formula |
| Regulatory status | Prohibited in sport; not approved as medicine | Status varies by country |
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
Cardarine is not approved for human therapeutic use in any major jurisdiction. It appears on the World Anti-Doping Agency Prohibited List as a PPARδ agonist within the hormone and metabolic modulators category. Sports organizations test for it because it has been detected in athlete samples and seized products. Regulatory actions against marketed research chemical versions have occurred in several countries, though enforcement varies. Availability through unregulated channels complicates oversight.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Laboratory studies indicate that GW501516 activates PPARδ, a nuclear receptor involved in fatty acid oxidation and energy metabolism. In rodent experiments, treated animals often showed increased endurance and reduced fat mass. These effects were observed under controlled conditions and do not establish safe or effective use in humans. The exact dose-response relationship in humans remains poorly characterized. Species differences in metabolism can affect how results translate across animals and people.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Animation – God of War Ragnarök Artistic Achievement – Tunic Audio Achievement – God of War Ragnarök Best Game – Vampire Survivors British Game – Rollerdrome Debut Game – Tunic EE Game of the Year – God of War Ragnarök Evolving Game – Final Fantasy XIV Online Family – Kirby and the Forgotten Land Game Beyond Entertainment – Endling: Extinction is Forever Game Design – Vampire Survivors Multiplayer – Elden Ring Music – God of War Ragnarök Narrative – Immortality Original Property – Elden Ring Performer in a Leading Role – Christopher Judge as Kratos in God of War Ragnarök Performer in a Supporting Role – Laya Deleon Hayes as Angrboða in God of War Ragnarök Technical Achievement – Horizon Forbidden West
==== MRGPRX2 mast cell receptor ==== Human mast-cell-specific G-protein-coupled receptor MRGPRX2 plays a key role in the recognition of pathogen associated molecular patterns (PAMPs) and initiating an antibacterial response. Binding of MRGPRX2 to competence stimulating peptide (CSP) 1, produced by Gram-positive bacteria, leads to signal transduction to a G protein and activation of the mast cell. Mast cell activation induces the release of antibacterial mediators including ROS, TNF-α and PRGD2 which institute the recruitment of other immune cells to inhibit bacterial growth and biofilm formation.
=== TCA cycle === When metabolites from the TCA cycle or glutamate are used as a precursor for glyceroneogenesis, the regulator in the TCA cycle can also cause fluctuations in the levels of products formed by glyceroneogenesis. Regulation of the TCA cycle is mainly determined by product inhibition and substrate availability. The TCA cycle will slow down when the environment contains excess product, or deficiency of the substrate such as ADP and NAD+.
After the US revoked his existing B1/B2 visa in 2005 and refused to accept his application for an A2 visa, the US State Department affirmed that the visa policy remained unchanged : "(Mr Modi) is welcome to apply for a visa and await a review like any other applicant". Exploring opportunities on how to move the relationship out of a state of morose, Lisa Curtis, senior research fellow for South Asia in the Asian Studies Center of The Heritage Foundation, says that, "the U.S. must first signal its willingness and commitment to collaborating with the new government—and that it will not dwell on the controversy of the 2002 Gujarat riots, which led the U.S. to revoke Modi's visa in 2005." In 2009, the U.S. Commission for International Religious Freedom (USCIRF) report after ignoring the views and decision of independent body (SIT) set up by India's highest judiciary vehemently alleged that there was "significant evidence" linking Narendra Modi to communal riots in the state in 2002 and asked the Obama administration to continue the policy of preventing him from travelling to the United States of America . The Obama administration maintained the 2005 decision taken by the George W. Bush administration to deny Narendra Modi entry into the United States of America. The US Government says that Modi can circumvent the USCIRF sanctions regime by visiting Washington on a Heads of government A1-visa as long as he is the Prime Minister of India.
The reduced ability of the kidneys to excrete sodium and water causes retention (medicine) of these substances and thus an increase in blood volume, which ultimately leads to an increase in blood pressure. About two thirds of all cats with CNE are affected. High blood pressure in turn leads to increased connective tissue formation. A potassium deficiency or excess calcium secondary to other kidney damage also causes further damage to the kidney tissue.
Sources: en.wikipedia.org
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
ICHR is funded by grants-in-aid received from the Department of Higher Education, Ministry of Education . It also receives funds from the various state governments of India and from other Ministries of the government of India.
== Function == Corin converts the atrial natriuretic peptide (ANP) precursor, pro-ANP, to mature ANP, a cardiac hormone that regulates salt-water balance and blood pressure. In mice, corin deficiency prevents pro-ANP processing and causes salt-sensitive hypertension. Corin may also function as a pro-brain-type natriuretic peptide convertase. Corin-mediated ANP production in the pregnant uterus promotes spiral artery remodeling and trophoblast invasion. CORIN mutations have been reported in patients with preeclampsia. In mice, corin functions in the dermal papilla to regulate coat color in an Agouti-dependent pathway.
Rodney local council would lose Orewa, Dairy Flat, and Whangaparaoa but retain the remainder of the current Rodney District. The split areas as well as the current North Shore City would form a Waitemata local council. Waitakere local council would consist of the current Waitakere City as well as the Avondale area. Tamaki Makaurau would consist of the current Auckland City and Otahuhu (excluding CBD) Manukau local council would consist of the urban parts of the current Manukau City and of the Papakura District. Hunua local council would consist of the entire Franklin District, much of which is currently in the Waikato Region, along with rural areas of the current Papakura District and Manukau City. The entire Papakura District would be dissolved between urban and rural councils. The National-led Government responded within about a week. Its plan, which went to a Select Committee, accepted the proposal for supercity and many community boards, but rejected proposals for local councils and, initially, no separate seats for Māori. Public reaction to the Royal Commission report was mixed, especially in regards to the Government's amended proposal. Auckland Mayor John Banks supported the amended merger plans. Criticism of the amended proposal came largely from residents in Manukau, Waitakere and North Shore Cities. In addition, Māori Affairs Minister Pita Sharples spoke against the exclusion of the Māori seats, as recommended by the Royal Commission. Opposition Leader Phil Goff called for a referendum on the issue.
=== Recording sessions === The album's recording sessions started in 2023; these sessions were split between Virginia, United States and the Louis Vuitton headquarters in Paris, France. As told by Andre Gee for Rolling Stone, the first makings of the album were after the 2023 Grammys, when Pusha T flew to Miami to work with Williams and Malice, ultimately choosing five beats. However, Gee's article goes on to use phrasing that implies nothing recorded in Miami made the album—"[Malice] prayed with his engineer before every recording session in Virginia. (Other sessions took place in Paris with Williams.)"—and no other source mentions Miami. Frazier Tharpe of GQ specifies that a majority of the album was recorded in Paris. The album was confirmed to be finished in December 2024. Some lyrics in "Ace Trumpets" were interpreted to be in response to rants by West in March and April 2025.
Sources: en.wikipedia.org
The Society recognizes achievements and promotes academic research through four annual awards. The Biemann Medal and the John B. Fenn Award for a Distinguished Contribution in Mass Spectrometry both are awarded in recognition of singular achievements or contributions in fundamental or applied mass spectrometry, with the Biemann Medal being focused on individuals who are early in their careers. The Ronald A. Hites Award is awarded for outstanding original research demonstrated in papers published in the Journal of the American Society for Mass Spectrometry. The Research Awards are given to young scientists in mass spectrometry, based on the evaluation of their proposed research. The Fellows of ASMS are awarded to individuals in recognition for their scientific contribution to mass spectrometry and for their contribution to the ASMS community. Journal of the American Society for Mass Spectrometry Measuring Mass: From Positive Rays to Proteins The past presidents of ASMS are:
c7orf26 (accession: NM_024067 / NP_076972; alias: MGC-2178) is located on the long arm of chromosome 7 (7p22.1), starting at 6590021 and ending at 6608726. The c7orf26 gene spans 2178 base pairs and is orientated on the + strand. The coding region is made up of a protein sequence measuring 449 amino acids long. It is divided into 6 transcripts containing a total of 24 exons on the forward strand and has 5952 unique Single Nucleotide Polymorphisms (SNPs). Genes ZDHHC4, ZNF853 and ZNF316 neighbor c7orf26 on chromosome 7. Gene ZDHHC4 is a zinc-finger protein involved with cytochrome-c oxidase activity and protein-cysteine S-palmitoyltransferase activity and has overlapping regions with c7orf26. Gene GRID2IP lies upstream by >2000 bp of c7orf26, and is heavily involved with in synaptogenesis and synaptic plasticity. c7orf26 is highly expressed in lymphatic, reproductive, and nervous tissue. These include the brain (frontal and occipital cortex), thymus glands, salivary glands, endometrium, cervix, and prostate. It is intermediately expressed in the lungs.
Inositol nicotinate, also known as inositol hexanicotinate or inositol hexaniacinate, is a compound of niacin (vitamin B3) and inositol. It is marketed in the United States as a "no-flush" form of niacin in dietary supplements. When ingested, inositol nicotinate breaks down into inositol and niacin. The niacin component helps widen blood vessels (vasodilation), lowers blood lipid levels (including cholesterol), and inhibits a protein involved in blood clotting. Inositol nicotinate is used to treat blood circulation problems, including: Raynaud's phenomenon Intermittent claudication Some research shows it can improve symptoms of Raynaud's phenomenon over several weeks. However, its effectiveness in treating other conditions like: High cholesterol High blood pressure Leg pain during exercise (due to poor circulation) remains unclear, with studies producing mixed results. Other proposed uses, such as for: Migraines Psoriasis Restless legs syndrome have insufficient supporting evidence. Inositol nicotinate is generally safe when taken by mouth, but possible side effects include:
The price for pure bismuth metal was relatively stable through most of the 20th century, except for a spike in the 1970s. Bismuth has always been produced mainly as a byproduct of lead refining, thus the price usually reflected the cost of recovery and the balance between production and demand. Before World War II, demand for bismuth was small and mainly pharmaceutical—bismuth compounds were used to treat such conditions as digestive disorders, sexually transmitted diseases, and burns. Minor amounts of bismuth metal were consumed in fusible alloys for fire sprinkler systems and fuse wire. During World War II, bismuth was considered a strategic material, used for solders, fusible alloys, medications, and atomic research. To stabilize the market, the producers set the price at $1.25 per pound ($2.75 /kg) during the war and at $2.25 per pound ($4.96 /kg) from 1950 until 1964. In the early 1970s, the price rose rapidly due to increasing demand for bismuth as a metallurgical additive to aluminium, iron, and steel. This was followed by a decline owing to increased world production, stabilized consumption, and the recessions of 1980 and 1981–1982. In 1984, the price began to climb as consumption increased worldwide, especially in the United States and Japan. In the early 1990s, research began on the evaluation of bismuth as a nontoxic replacement for lead in ceramic glazes, fishing sinkers, food-processing equipment, free-machining brasses for plumbing applications, lubricating greases, and shot for waterfowl hunting.
Admiral Brad Cooper said that the US military had struck more than 8,000 Iranian military targets, including 130 vessels. On 21 March, the US conducted strikes on the Natanz Nuclear Facility using bunker buster bombs to target the site. Russia condemned the strikes on Natanz as a "blatant violation of international law" while the IAEA urged military restraint "to avoid any risk of a nuclear accident". In response, Iran struck the southern Israeli town of Dimona, injuring at least 78 people. Iran said that it targeted the Shimon Peres Negev Nuclear Research Center. Citing unnamed US officials, CNN and The Wall Street Journal reported that Iran unsuccessfully attempted to strike the joint US–UK military base at Diego Garcia on the Chagos Islands in the British Indian Ocean Territory. The report said one of the missiles broke apart mid-flight, while another was intercepted by a SM-3 air defense missile launched by a US warship. Israel said that Iran used a two-stage intercontinental ballistic missile to target the island. Iran denied launching missiles towards Diego Garcia, saying that it was an Israeli false flag attack. In response the UK foreign secretary confirmed and denounced the Iranian attack on their end, and additionally expanded permission for the United States to bomb certain targets using their bases. No evidence has been presented that the alleged Iranian missiles neared Diego Garcia or that one was intercepted.
Sources: en.wikipedia.org
No. Cardarine is GW501516, a PPARδ agonist, while SARMs act on androgen receptors. The two classes are often grouped in informal discussions despite different mechanisms.
No. It has no approved medical indication in any country. Regulatory agencies have not cleared it for treatment or prevention of any condition.
Early clinical work stopped after rodent carcinogenicity findings. Those animal results raised concerns about long-term human risk, although direct human evidence is lacking. The human relevance of the tumors remains an open scientific question.
LC-MS/MS is common, often after sample cleanup. The assay targets GW501516 or its metabolites.